PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca29384.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 352aa    MW: 39516.3 Da    PI: 8.2447
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca29384.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.56.4e-54101401129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 +ppGfrFhPtdeel+ +yLkkk++ + ++l +vi+evd++k+ePwdL+   ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk++++ +
  Dca29384.1  10 VPPGFRFHPTDEELLYYYLKKKISYEAIDL-DVIREVDLNKLEPWDLKDrcRIGTgPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAIYHVN 107
                 69****************************.9***************943444442456**************************************** PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrle 129
                  + +g++ktLvfy+grap+g+ktdW+mheyrle
  Dca29384.1 108 AKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRLE 140
                 *******************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-594160IPR003441NAC domain
PROSITE profilePS5100558.05410160IPR003441NAC domain
PfamPF023654.4E-2811139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MMPSNGPLSV PPGFRFHPTD EELLYYYLKK KISYEAIDLD VIREVDLNKL EPWDLKDRCR  60
IGTGPQNEWY FFSHKDKKYP TGTRTNRATT AGFWKATGRD KAIYHVNAKR IGMRKTLVFY  120
TGRAPHGQKT DWIMHEYRLE DDHSHFQQED GWVVCRVFKK KSHGRGGIQA ELLHQDDDYD  180
NSNPTYGSSG HHMMKSSHHS GTSPPPLQPR NNNYTQPLLF PSNYNYTFDG TMHLPQLSSP  240
DTLTGGGTNL LSTMDNLLRL TTPGGPAGGG GGGVGVLNAQ QLMVGGPEWG FLDKLLANYQ  300
GIDPQQDVSR DKVMLGGGHD IVGTSSGNSL NHHKFPFQYL GPDQSELFKF SK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-49816515170NO APICAL MERISTEM PROTEIN
1ut4_B3e-49816515170NO APICAL MERISTEM PROTEIN
1ut7_A3e-49816515170NO APICAL MERISTEM PROTEIN
1ut7_B3e-49816515170NO APICAL MERISTEM PROTEIN
3swm_A3e-49816518173NAC domain-containing protein 19
3swm_B3e-49816518173NAC domain-containing protein 19
3swm_C3e-49816518173NAC domain-containing protein 19
3swm_D3e-49816518173NAC domain-containing protein 19
3swp_A3e-49816518173NAC domain-containing protein 19
3swp_B3e-49816518173NAC domain-containing protein 19
3swp_C3e-49816518173NAC domain-containing protein 19
3swp_D3e-49816518173NAC domain-containing protein 19
4dul_A3e-49816515170NAC domain-containing protein 19
4dul_B3e-49816515170NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1158162KKKSH
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010680384.11e-158PREDICTED: NAC domain-containing protein 76-like
TrEMBLA0A0J8D5N41e-158A0A0J8D5N4_BETVU; Uncharacterized protein
STRINGPOPTR_0010s18420.11e-126(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.38e-80NAC family protein